Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.50

Knowledge Summary

Patent (71)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MTNTSSSDFTLLGLLVNSEAAGIVFTVILAVFLGAVTANLVMIFLIQVDSRLHTPMYFLLSQLSIMDTLF      1 - 70
ICTTVPKLLADMVSKEKIISFVACGIQIFLYLTMIGSEFFLLGLMAYDCYVAVCNPLRYPVLMNRKKCLL     71 - 140
LAAGAWFGGSLDGFLLTPITMNVPYCGSRSINHFFCEIPAVLKLACADTSLYETLMYICCVLMLLIPISI    141 - 210
ISTSYSLILLTIHRMPSAEGRKKAFTTCSSHLTVVSIFYGAAFYTYVLPQSFHTPEQDKVVSAFYTIVTP    211 - 280
MLNPLIYSLRNKDVIGAFKKVFACCSSAQKVATSDA                                      281 - 316
//

Text Mined References (4)

PMID Year Title