Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (102)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.4e-09
diabetes mellitus 1728 1.5e-02

AA Sequence

MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMYFFINQLSLID      1 - 70
LTYISVTVPKMLVNQLAKDKTISVLGCGTQMYFYLQLGGAECCLLAAMAYDRYVAICHPLRYSVLMSHRV     71 - 140
CLLLASGCWFVGSVDGFMLTPIAMSFPFCRSHEIQHFFCEVPAVLKLSCSDTSLYKIFMYLCCVIMLLIP    141 - 210
VTVISVSYYYIILTIHKMNSVEGRKKAFTTCSSHITVVSLFYGAAIYNYMLPSSYQTPEKDMMSSFFYTI    211 - 280
LTPVLNPIIYSFRNKDVTRALKKMLSVQKPPY                                          281 - 312
//

Text Mined References (3)

PMID Year Title