Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 28.42

Knowledge Summary

Patent (126)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Skin cancer 469 0.0 0.5
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Intracranial aneurysm 24 3.264 1.6

AA Sequence

MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMYFFLSNLSLLD      1 - 70
ICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMALDRYIAVCKPLHYVVIMNPRL     71 - 140
CQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICEVPALLKLACVDTTVNELVLFVVSVLFVVIP    141 - 210
PALISISYGFITQAVLRIKSVEARHKAFSTCSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTM    211 - 280
VTPTLNPIIYTLRNKDMKEALRKLLSGKL                                             281 - 309
//

Text Mined References (4)

PMID Year Title