Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (94)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MTNQTQMMEFLLVRFTENWVLLRLHALLFSLIYLTAVLMNLVIILLMILDHRLHMAMYFFLRHLSFLDLC      1 - 70
LISATVPKSILNSVASTDSISFLGCVLQLFLVVLLAGSEIGILTAMSYDRYAAICCPLHCEAVMSRGLCV     71 - 140
QLMALSWLNRGALGLLYTAGTFSLNFYGSDELHQFFCDVPALLKLTCSKEHAIISVSVAIGVCYAFSCLV    141 - 210
CIVVSYVYIFSAVLRISQRQRQSKAFSNCVPHLIVVTVFLVTGAVAYLKPGSDAPSILDLLVSVFYSVAP    211 - 280
PTLNPVIYCLKNKDIKSALSKVLWNVRSSGVMKR                                        281 - 314
//

Text Mined References (5)

PMID Year Title
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11337468 2001 The complete human olfactory subgenome.