Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 18.50

Knowledge Summary

Patent (159)

AA Sequence

MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMYHFVSVLSFLE      1 - 70
LWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAYDRYLAICRPLHYPIIMTTTL     71 - 140
CAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCDFPPLLSLACKDTSANILVDFAINAFIILIT    141 - 210
FFFIMISYARIIGAVLKIKTASGRKKAFSTCASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSV    211 - 280
LTPMVNPIIYSLRNKEIIKAIKRTIFQKGDKASLAHL                                     281 - 317
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.