Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent (129)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
diabetes mellitus 1663 0.00139778003487013
Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0
Disease Target Count Z-score Confidence
Pulmonary edema 14 3.127 1.6

Synonym

Accession Q8NGY1 Q5VYL0 Q6IFR7
Symbols OR1-15

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGQTNVTSWRDFVFLGFSSSGELQLLLFALFLSLYLVTLTSNVFIIIAIRLDSHLHTPMYLFLSFLSFSE      1 - 70
TCYTLGIIPRMLSGLAGGDQAISYVGCAAQMFFSASWACTNCFLLAAMGFDRYVAICAPLHYASHMNPTL     71 - 140
CAQLVITSFLTGYLFGLGMTLVIFHLSFCSSHEIQHFFCDTPPVLSLACGDTGPSELRIFILSLLVLLVS    141 - 210
FFFITISYAYILAAILRIPSAEGQKKAFSTCASHLTVVIIHYGCASFVYLRPKASYSLERDQLIAMTYTV    211 - 280
VTPLLNPIVYSLRNRAIQTALRNAFRGRLLGKG                                         281 - 313
//

Text Mined References (4)

PMID Year Title
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.