Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent (129)

TINX Plot

  Disease Relevance (3)

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGQTNVTSWRDFVFLGFSSSGELQLLLFALFLSLYLVTLTSNVFIIIAIRLDSHLHTPMYLFLSFLSFSE      1 - 70
TCYTLGIIPRMLSGLAGGDQAISYVGCAAQMFFSASWACTNCFLLAAMGFDRYVAICAPLHYASHMNPTL     71 - 140
CAQLVITSFLTGYLFGLGMTLVIFHLSFCSSHEIQHFFCDTPPVLSLACGDTGPSELRIFILSLLVLLVS    141 - 210
FFFITISYAYILAAILRIPSAEGQKKAFSTCASHLTVVIIHYGCASFVYLRPKASYSLERDQLIAMTYTV    211 - 280
VTPLLNPIVYSLRNRAIQTALRNAFRGRLLGKG                                         281 - 313
//

Text Mined References (4)

PMID Year Title
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.