Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent (129)

TINX Plot

  Disease (4)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0
Disease Target Count Z-score Confidence
Pulmonary edema 17 3.15 1.6

Gene RIF (1)

AA Sequence

MGQTNVTSWRDFVFLGFSSSGELQLLLFALFLSLYLVTLTSNVFIIIAIRLDSHLHTPMYLFLSFLSFSE      1 - 70
TCYTLGIIPRMLSGLAGGDQAISYVGCAAQMFFSASWACTNCFLLAAMGFDRYVAICAPLHYASHMNPTL     71 - 140
CAQLVITSFLTGYLFGLGMTLVIFHLSFCSSHEIQHFFCDTPPVLSLACGDTGPSELRIFILSLLVLLVS    141 - 210
FFFITISYAYILAAILRIPSAEGQKKAFSTCASHLTVVIIHYGCASFVYLRPKASYSLERDQLIAMTYTV    211 - 280
VTPLLNPIVYSLRNRAIQTALRNAFRGRLLGKG                                         281 - 313
//

Text Mined References (4)

PMID Year Title