Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 172.83

Knowledge Summary

Patent (463)


  Disease Sources (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Gene RIF (1)

20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LTPLFNPMIYSLRNKEFKSALRRTIGQTFYPLS                                         281 - 313

Text Mined References (5)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.