Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 126.73

Knowledge Summary

Patent (397)

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRGFNKTTVVTQFILVGFSSLGELQLLLFVIFLLLYLTILVANVTIMAVIRFSWTLHTPMYGFLFILSFS      1 - 70
ESCYTFVIIPQLLVHLLSDTKTISFMACATQLFFFLGFACTNCLLIAVMGYDRYVAICHPLRYTLIINKR     71 - 140
LGLELISLSGATGFFIALVATNLICDMRFCGPNRVNHYFCDMAPVIKLACTDTHVKELALFSLSILVIMV    141 - 210
PFLLILISYGFIVNTILKIPSAEGKKAFVTCASHLTVVFVHYGCASIIYLRPKSKSASDKDQLVAVTYTV    211 - 280
VTPLLNPLVYSLRNKEVKTALKRVLGMPVATKMS                                        281 - 314
//

Text Mined References (3)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.