Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.59

Knowledge Summary

Patent (128)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Exfoliation Syndrome 12 3.763 1.9

AA Sequence

MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMYMFLQHLSFLE      1 - 70
VWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAYDRYLAICSPLRYPFLMHRGL     71 - 140
CARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCDLPPLMQLSCSRVYITEVTIFILSIAVLCIC    141 - 210
FFLTLGPYVFIVSSILRIPSTSGRRKTFSTCGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTV    211 - 280
VTPLLNPVIYSLRNKDFKEAVRKVMRRKCGILWSTSKRKFLY                                281 - 322
//

Text Mined References (3)

PMID Year Title