Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 6.50

Knowledge Summary

Patent (97)

AA Sequence

MSNEDMEQDNTTLLTEFVLTGLTYQPEWKMPLFLVFLVIYLITIVWNLGLIALIWNDPQLHIPMYFFLGS      1 - 70
LAFVDAWISSTVTPKMLVNFLAKNRMISLSECMIQFFSFAFGGTTECFLLATMAYDRYVAICKPLLYPVI     71 - 140
MNNSLCIRLLAFSFLGGFLHALIHEVLIFRLTFCNSNIIHHFYCDIIPLFMISCTDPSINFLMVFILSGS    141 - 210
IQVFTIVTVLNSYTFALFTILKKKSVRGVRKAFSTCGAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDS    211 - 280
VFYTIIIPLLNPIIYSLRNKQVIDSFTKMVKRNV                                        281 - 314
//

Text Mined References (3)

PMID Year Title
19483685 2009 HLA-B*5701 genotype is a major determinant of drug-induced liver injury due to flucloxacillin.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14983052 2004 The human olfactory receptor gene family.