Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 5.58

Knowledge Summary

Patent (172)

AA Sequence

MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLGLIVLIWKDPH      1 - 70
LHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSLVTTVTTECFLLATMAYDRYV     71 - 140
AICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSFRLTFCNSNIIQHFYCDIIPLLKISCTDSSI    141 - 210
NFLMVFIFAGSVQVFTIGTILISYTIILFTILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSAS    211 - 280
PQADDQDMMESLFYTVIVPLLNPMIYSLRNKQVIASFTKMFKSNV                             281 - 325
//

Text Mined References (5)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.