Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.44
PubTator Score 0.68

Knowledge Summary

Patent (466)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
breast carcinoma 1638 1.9e-02

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 1.9e-02

AA Sequence

MEDLFSPSILPPAPNISVPILLGWGLNLTLGQGAPASGPPSRRVRLVFLGVILVVAVAGNTTVLCRLCGG      1 - 70
GGPWAGPKRRKMDFLLVQLALADLYACGGTALSQLAWELLGEPRAATGDLACRFLQLLQASGRGASAHLV     71 - 140
VLIALERRRAVRLPHGRPLPARALAALGWLLALLLALPPAFVVRGDSPSPLPPPPPPTSLQPGAPPAARA    141 - 210
WPGERRCHGIFAPLPRWHLQVYAFYEAVAGFVAPVTVLGVACGHLLSVWWRHRPQAPAAAAPWSASPGRA    211 - 280
PAPSALPRAKVQSLKMSLLLALLFVGCELPYFAARLAAAWSSGPAGDWEGEGLSAALRVVAMANSALNPF    281 - 350
VYLFFQAGDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPP    351 - 420
PRPRPLPCSCESAF                                                            421 - 434
//

Text Mined References (6)

PMID Year Title