Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.42
PubTator Score 0.68

Knowledge Summary

Patent (466)

TINX Plot

  Disease Sources (2)

Disease Target Count
ovarian neoplasm 97
Disease Target Count P-value
breast carcinoma 1614 0.0185765850831941

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 0.019

Synonym

Accession Q8NGU9
Symbols PGR11

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Xenopus OMA EggNOG

  TechDev Info (1)

AA Sequence

MEDLFSPSILPPAPNISVPILLGWGLNLTLGQGAPASGPPSRRVRLVFLGVILVVAVAGNTTVLCRLCGG      1 - 70
GGPWAGPKRRKMDFLLVQLALADLYACGGTALSQLAWELLGEPRAATGDLACRFLQLLQASGRGASAHLV     71 - 140
VLIALERRRAVRLPHGRPLPARALAALGWLLALLLALPPAFVVRGDSPSPLPPPPPPTSLQPGAPPAARA    141 - 210
WPGERRCHGIFAPLPRWHLQVYAFYEAVAGFVAPVTVLGVACGHLLSVWWRHRPQAPAAAAPWSASPGRA    211 - 280
PAPSALPRAKVQSLKMSLLLALLFVGCELPYFAARLAAAWSSGPAGDWEGEGLSAALRVVAMANSALNPF    281 - 350
VYLFFQAGDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPP    351 - 420
PRPRPLPCSCESAF                                                            421 - 434
//

Text Mined References (3)

PMID Year Title
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.