Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.42
PubTator Score 0.68

Knowledge Summary

Patent (466)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
ovarian neoplasm 97

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 0.019

AA Sequence

MEDLFSPSILPPAPNISVPILLGWGLNLTLGQGAPASGPPSRRVRLVFLGVILVVAVAGNTTVLCRLCGG      1 - 70
GGPWAGPKRRKMDFLLVQLALADLYACGGTALSQLAWELLGEPRAATGDLACRFLQLLQASGRGASAHLV     71 - 140
VLIALERRRAVRLPHGRPLPARALAALGWLLALLLALPPAFVVRGDSPSPLPPPPPPTSLQPGAPPAARA    141 - 210
WPGERRCHGIFAPLPRWHLQVYAFYEAVAGFVAPVTVLGVACGHLLSVWWRHRPQAPAAAAPWSASPGRA    211 - 280
PAPSALPRAKVQSLKMSLLLALLFVGCELPYFAARLAAAWSSGPAGDWEGEGLSAALRVVAMANSALNPF    281 - 350
VYLFFQAGDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPP    351 - 420
PRPRPLPCSCESAF                                                            421 - 434
//

Text Mined References (3)

PMID Year Title
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.