Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 0.000
psoriasis 2.200 0.000

AA Sequence

MLANQASAEERFLLLGFSDWPSLQPVLFALVLLCYLLTLTGNSALVLLAVRDPRLHTPMYYFLCHLALVD      1 - 70
AGFTTSVVPPLLANLRGPALWLPRSHCTAQLCASLALGSAECVLLAVMALDRAAAVCRPLRYAGLVSPRL     71 - 140
CRTLASASWLSGLTNSVAQTALLAERPLCAPRLLDHFICELPALLKLACGGDGDTTENQMFAARVVILLL    141 - 210
PFAVILASYGAVARAVCCMRFSGGRRRAVGTCGSHLTAVCLFYGSAIYTYLQPAQRYNQARGKFVSLFYT    211 - 280
VVTPALNPLIYTLRNKKVKGAARRLLRSLGRGQAGQ                                      281 - 316
//

Text Mined References (2)

PMID Year Title
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
14983052 2004 The human olfactory receptor gene family.