Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-40
ovarian cancer 8520 3.3e-06

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 3.3e-06
psoriasis 2.200 2.6e-40

AA Sequence

MLANQASAEERFLLLGFSDWPSLQPVLFALVLLCYLLTLTGNSALVLLAVRDPRLHTPMYYFLCHLALVD      1 - 70
AGFTTSVVPPLLANLRGPALWLPRSHCTAQLCASLALGSAECVLLAVMALDRAAAVCRPLRYAGLVSPRL     71 - 140
CRTLASASWLSGLTNSVAQTALLAERPLCAPRLLDHFICELPALLKLACGGDGDTTENQMFAARVVILLL    141 - 210
PFAVILASYGAVARAVCCMRFSGGRRRAVGTCGSHLTAVCLFYGSAIYTYLQPAQRYNQARGKFVSLFYT    211 - 280
VVTPALNPLIYTLRNKKVKGAARRLLRSLGRGQAGQ                                      281 - 316
//

Text Mined References (2)

PMID Year Title