Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.58
PubTator Score 0.33

Knowledge Summary

Patent (131)

Expression

AA Sequence

MNITLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEVVLFVFSLVMYLTTLLG      1 - 70
NSTLILITILDSRLKTPMYLFLGNLSFMDICYTSASVPTLLVNLLSSQKTIIFSGCAVQMYLSLAMGSTE     71 - 140
CVLLAVMAYDRYVAICNPLRYSIIMNRCVCARMATVSWVTGCLTALLETSFALQIPLCGNLIDHFTCEIL    141 - 210
AVLKLACTSSLLMNTIMLVVSILLLPIPMLLVCISYIFILSTILRITSAEGRNKAFSTCGAHLTVVILYY    211 - 280
GAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAMKKLLGKITLHQTHEHL         281 - 345
//

Text Mined References (8)

PMID Year Title