Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.58
PubTator Score 0.33

Knowledge Summary

Patent (131)

Expression

AA Sequence

MNITLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEVVLFVFSLVMYLTTLLG      1 - 70
NSTLILITILDSRLKTPMYLFLGNLSFMDICYTSASVPTLLVNLLSSQKTIIFSGCAVQMYLSLAMGSTE     71 - 140
CVLLAVMAYDRYVAICNPLRYSIIMNRCVCARMATVSWVTGCLTALLETSFALQIPLCGNLIDHFTCEIL    141 - 210
AVLKLACTSSLLMNTIMLVVSILLLPIPMLLVCISYIFILSTILRITSAEGRNKAFSTCGAHLTVVILYY    211 - 280
GAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAMKKLLGKITLHQTHEHL         281 - 345
//

Text Mined References (8)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
17010214 2006 Ancient genomic architecture for mammalian olfactory receptor clusters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.