Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10

Knowledge Summary

Patent (123)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Bronchiolitis 18 3.757 1.9

AA Sequence

MEWENHTILVEFFLKGLSGHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMYFFLGNLSFLD      1 - 70
ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFDRYVAICNPLRYPIIMSKDA     71 - 140
YVPMAAGSWIIGAVNSAVQTVFVVQLPFCRNNIINHFTCEILAVMKLACADISGNEFILLVTTTLFLLTP    141 - 210
LLLIIVSYTLIILSIFKISSSEGRSKPSSTCSARLTVVITFCGTIFLMYMKPKSQETLNSDDLDATDKLI    211 - 280
FIFYRVMTPMMNPLIYSLRNKDVKEAVKHLLRRKNFNK                                    281 - 318
//

Text Mined References (5)

PMID Year Title