Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (123)

AA Sequence

FIFYRVMTPMMNPLIYSLRNKDVKEAVKHLLRRKNFNK                                    281 - 318

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.