Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 4.50

Knowledge Summary

Patent (173)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1683 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

AA Sequence

MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMYFFLGNLSFLD      1 - 70
ICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAFDRYVAICNPLRYPIIMNKVV     71 - 140
YVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCEILAVLKLACSDISVNIVTLAVSNIAFLVLP    141 - 210
LLVIFFSYMFILYTILRTNSATGRHKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLV    211 - 280
SMFYGVVTPMLNPIIYSLRNKDVKAAIKYLLSRKAINQ                                    281 - 318
//

Text Mined References (6)

PMID Year Title