Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 4.50

Knowledge Summary

Patent (173)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMYFFLGNLSFLD      1 - 70
ICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAFDRYVAICNPLRYPIIMNKVV     71 - 140
YVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCEILAVLKLACSDISVNIVTLAVSNIAFLVLP    141 - 210
LLVIFFSYMFILYTILRTNSATGRHKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLV    211 - 280
SMFYGVVTPMLNPIIYSLRNKDVKAAIKYLLSRKAINQ                                    281 - 318
//

Text Mined References (6)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.