Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 9.33

Knowledge Summary

Patent (105)

AA Sequence

QTPMLNPIIYSLRNKEVKVALKKLLIRNHFNTAFISILK                                   281 - 319

Text Mined References (3)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.