Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.50
PubTator Score 2.00

Knowledge Summary

Patent (176)

AA Sequence

MSPENQSSVSEFLLLGLPIRPEQQAVFFALFLGMYLTTVLGNLLIMLLIQLDSHLHTPMYFFLSHLALTD      1 - 70
ISFSSVTVPKMLMNMQTQHLAVFYKGCISQTYFFIFFADLDSFLITSMAYDRYVAICHPLHYATIMTQSQ     71 - 140
CVMLVAGSWVIACACALLHTLLLAQLSFCADHIIPHYFCDLGALLKLSCSDTSLNQLAIFTAALTAIMLP    141 - 210
FLCILVSYGHIGVTILQIPSTKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA    211 - 280
VTPMLNPFIYSLRNKDIKGALRKLLSRSGAVAHACNLNTLGG                                281 - 322
//

Text Mined References (5)

PMID Year Title