Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (199)

AA Sequence

MKRENQSSVSEFLLLDLPIWPEQQAVFFTLFLGMYLITVLGNLLIILLIRLDSHLHTPMFFFLSHLALTD      1 - 70
ISLSSVTVPKMLLSMQTQDQSILYAGCVTQMYFFIFFTDLDNFLLTSMAYDRYVAICHPLRYTTIMKEGL     71 - 140
CNLLVTVSWILSCTNALSHTLLLAQLSFCADNTIPHFFCDLVALLKLSCSDISLNELVIFTVGQAVITLP    141 - 210
LICILISYGHIGVTILKAPSTKGIFKALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTV    211 - 280
ITPLLNPFIYSLRNRDIKGALERLFNRATVLSQ                                         281 - 313
//

Text Mined References (5)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.