Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.17
PubTator Score 7.71

Knowledge Summary

Patent (501)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.416 1.7

Gene RIF (1)

AA Sequence

MMSFAPNASHSPVFLLLGFSRANISYTLLFFLFLAIYLTTILGNVTLVLLISWDSRLHSPMYYLLRGLSV      1 - 70
IDMGLSTVTLPQLLAHLVSHYPTIPAARCLAQFFFFYAFGVTDTLVIAVMALDRYVAICDPLHYALVMNH     71 - 140
QRCACLLALSWVVSILHTMLRVGLVLPLCWTGDAGGNVNLPHFFCDHRPLLRASCSDIHSNELAIFFEGG    141 - 210
FLMLGPCALIVLSYVRIGAAILRLPSAAGRRRAVSTCGSHLTMVGFLYGTIICVYFQPPFQNSQYQDMVA    211 - 280
SVMYTAITPLANPFVYSLHNKDVKGALCRLLEWVKVDP                                    281 - 318
//

Text Mined References (6)

PMID Year Title