Property Summary

NCBI Gene PubMed Count 5
Grant Count 6
R01 Count 6
Funding $180,329.13
PubMed Score 2.17
PubTator Score 7.71

Knowledge Summary

Patent (501)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Colorectal adenoma 15 3.406 1.7

Gene RIF (1)

PMID Text
18328065 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMSFAPNASHSPVFLLLGFSRANISYTLLFFLFLAIYLTTILGNVTLVLLISWDSRLHSPMYYLLRGLSV      1 - 70
IDMGLSTVTLPQLLAHLVSHYPTIPAARCLAQFFFFYAFGVTDTLVIAVMALDRYVAICDPLHYALVMNH     71 - 140
QRCACLLALSWVVSILHTMLRVGLVLPLCWTGDAGGNVNLPHFFCDHRPLLRASCSDIHSNELAIFFEGG    141 - 210
FLMLGPCALIVLSYVRIGAAILRLPSAAGRRRAVSTCGSHLTMVGFLYGTIICVYFQPPFQNSQYQDMVA    211 - 280
SVMYTAITPLANPFVYSLHNKDVKGALCRLLEWVKVDP                                    281 - 318
//

Text Mined References (6)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
18328065 2008 Common null variant, Arg192Stop, in a G-protein coupled receptor, olfactory receptor 1B1, associated with decreased serum cholinesterase activity.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.