Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent (139)

TINX Plot

  Disease Relevance (2)

AA Sequence

METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPMYFFLSNLSFM      1 - 70
DICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPW     71 - 140
HCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVT    141 - 210
PFLCTIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYT    211 - 280
VVTPMLNPFIYSLRNKDMKRGLKKLRHRIYS                                           281 - 311
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.