Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent (139)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 3.0

AA Sequence

METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPMYFFLSNLSFM      1 - 70
DICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPW     71 - 140
HCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVT    141 - 210
PFLCTIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYT    211 - 280
VVTPMLNPFIYSLRNKDMKRGLKKLRHRIYS                                           281 - 311
//

Text Mined References (2)

PMID Year Title