Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent (139)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00132842062792477
Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 2.0

Synonym

Accession Q8NGR5 Q6IFN0 Q96R81
Symbols OR1L5
OR9-E
OR9-29
OST046

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid

AA Sequence

METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPMYFFLSNLSFM      1 - 70
DICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPW     71 - 140
HCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVT    141 - 210
PFLCTIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYT    211 - 280
VVTPMLNPFIYSLRNKDMKRGLKKLRHRIYS                                           281 - 311
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.