Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 12.00

Knowledge Summary

Patent (197)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLHTPMYFFLANL      1 - 70
SLLDACYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLAAMAYDRYVAIRNPLLYTTAM     71 - 140
SQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRSRKINSFFCDIPPLLAISCSDTSLNELLLFAICGFI    141 - 210
QTATVLAITVSYGFIAGAVIHMRSVEGSRRAASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASV    211 - 280
FYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPGQGSQ                                  281 - 320
//

Text Mined References (4)

PMID Year Title