Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 12.00

Knowledge Summary

Patent (197)


  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

FYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPGQGSQ                                  281 - 320

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.