Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (625)

Expression

Gene RIF (1)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEAANESSEGISFVLLGLTTSPGQQRPLFVLFLLLYVASLLGNGLIVAAIQASPALHAPMYFLLAHLSFA      1 - 70
DLCFASVTVPKMLANLLAHDHSISLAGCLTQMYFFFALGVTDSCLLAAMAYDCYVAIRHPLPYATRMSRA     71 - 140
MCAALVGMAWLVSHVHSLLYILLMARLSFCASHQVPHFFCDHQPLLRLSCSDTHHIQLLIFTEGAAVVVT    141 - 210
PFLLILASYGAIAAAVLQLPSASGRLRAVSTCGSHLAVVSLFYGTVIAVYFQATSRREAEWGRVATVMYT    211 - 280
VVTPMLNPIIYSLWNRDVQGALRALLIGRRISASDS                                      281 - 316
//

Text Mined References (5)

PMID Year Title
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.