Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 6.50

Knowledge Summary

Patent (349)

AA Sequence

MSYFYRLKLMKEAVLVKLPFTSLPLLLQTLSRKSRDMEIKNYSSSTSGFILLGLSSNPQLQKPLFAIFLI      1 - 70
MYLLAAVGNVLIIPAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGCLAQMYF     71 - 140
FMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPRHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHI    141 - 210
IKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFSTCGS    211 - 280
HLTAVALFYGSIIYVYFRPLSMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLQDRIYR       281 - 347
//

Text Mined References (3)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.