Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11

Knowledge Summary

Patent (180)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 0.00241773663288453

Synonym

Accession Q8NGQ5 Q2TAN3 Q96RA7
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid

AA Sequence

MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMYFLLSHLAFMD      1 - 70
VCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAYDRYLAVCQPLLYVTILTQQA     71 - 140
RLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCDLPPLLKLTCGESYTQEVLIIMFAIFVIPAS    141 - 210
MVVILVSYLFIIVAIMGIPAGSQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEV    211 - 280
IPMLNPLIYSLRNKEVKEALRKILNRAKLS                                            281 - 310
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.