Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11

Knowledge Summary

Patent (180)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMYFLLSHLAFMD      1 - 70
VCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAYDRYLAVCQPLLYVTILTQQA     71 - 140
RLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCDLPPLLKLTCGESYTQEVLIIMFAIFVIPAS    141 - 210
MVVILVSYLFIIVAIMGIPAGSQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEV    211 - 280
IPMLNPLIYSLRNKEVKEALRKILNRAKLS                                            281 - 310
//

Text Mined References (3)

PMID Year Title