Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.11

Knowledge Summary

Patent (137)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRPMYFFLTHLSC      1 - 70
LEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLAAMAYDRYVAICMPLHYGAFV     71 - 140
SWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDHFSCDASPLLALSCSDVTWKETVDFLVSLAV    141 - 210
LLASSMVIAVSYGNIVWTLLHIRSAAERWKAFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSV    211 - 280
FYSVVTPMLNPLIYSLRNKEVKGALGRVFSLNFWKGQ                                     281 - 317
//

Text Mined References (9)

PMID Year Title