Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.11

Knowledge Summary

Patent (137)

AA Sequence

MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRPMYFFLTHLSC      1 - 70
LEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLAAMAYDRYVAICMPLHYGAFV     71 - 140
SWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDHFSCDASPLLALSCSDVTWKETVDFLVSLAV    141 - 210
LLASSMVIAVSYGNIVWTLLHIRSAAERWKAFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSV    211 - 280
FYSVVTPMLNPLIYSLRNKEVKGALGRVFSLNFWKGQ                                     281 - 317
//

Text Mined References (9)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.