Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent (101)


  Disease Sources (1)

Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 1.0

AA Sequence

IIPMLNPLIYSLRNKDVKAAFKKLIGKKSQ                                            281 - 310

Text Mined References (6)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.