Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent (101)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.1

AA Sequence

MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMYFFLCNLSFVD      1 - 70
LGYSSAIAPRMLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAYGRFVAICRPLHYSTFMSKQV     71 - 140
CLALMLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCEIPPLLALSCSDTYISEILLFSLCGFIEFST    141 - 210
ILIIFISYTFILVAIIRMRSAEGRLKAFSTCGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTV    211 - 280
IIPMLNPLIYSLRNKDVKAAFKKLIGKKSQ                                            281 - 310
//

Text Mined References (6)

PMID Year Title