Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cardiovascular system disease 194 2.0

AA Sequence

MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMSFFLAGLTFIDII      1 - 70
YSSSISPRLISDLFFGNNSISFQSFMAQLFIEHLFGGSEVFLLLVMAYDRYVAICKPLHYLVIMRQWVCV     71 - 140
LLLVVSWVGGFLQSVFQLSIIYGLPFCGPNVIDHFFCDMYPLLKLACTDTHVIGLLVVANGGLSCTIAFL    141 - 210
LLLISYGVILHSLKKLSQKGRQKAHSTCSSHITVVVFFFVPCIFMCARPARTFSIDKSVSVFYTVITPML    211 - 280
NPLIYTLRNSEMTSAMKKL                                                       281 - 299
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.