Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (104)


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00298207732401217

AA Sequence

LFNPVVYTLRNKEVKKALLKLKNGSVFAQGE                                           281 - 311

Text Mined References (2)

PMID Year Title
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
14983052 2004 The human olfactory receptor gene family.