Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (98)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

LLNPVVYTLRNKEVKKALLKLKDKVAHSQSK                                           281 - 311

Text Mined References (3)

PMID Year Title