Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent (99)

Gene RIF (2)

PMID Text
24316890 This study verified that variations in OR10G4 genotype explain over 15% of the observed variation in perceived intensity and over 10% of the observed variation in perceived valence for the high-affinity in vitro agonist guaiacol.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYFLTNLSFIDMW      1 - 70
FSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYDRYLAISYPLRYTSMMSGSRC     71 - 140
ALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDAPPILKLACADTSANVMVIFVDIGIVASGCF    141 - 210
VLIVLSYVSIVCSILRIRTSDGRRRAFQTCASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTP    211 - 280
LLNPVVYTLRNKEVKKAVLKLRDKVAHPQRK                                           281 - 311
//

Text Mined References (3)

PMID Year Title
24316890 2014 The missense of smell: functional variability in the human odorant receptor repertoire.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14983052 2004 The human olfactory receptor gene family.