Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (150)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Synonym

Accession Q8NGM1 Q6IFE2
Symbols OR11-127
OR11-134

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Dog OMA EggNOG
Opossum OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG

AA Sequence

MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYFFLGFLSFLDA      1 - 70
CFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYDRYVAICKPLHYSSIMNRRLC     71 - 140
GILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDLYPLLELACTDTHIFGLMVVINSGFICIINF    141 - 210
SLLLVSYAVILLSLRTHSSEGRWKALSTCGSHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPL    211 - 280
LNPLIYTFRNKEVKQAMRRIWNRLMVVSDEKENIKL                                      281 - 316
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.