Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (150)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5

AA Sequence

LNPLIYTFRNKEVKQAMRRIWNRLMVVSDEKENIKL                                      281 - 316

Text Mined References (2)

PMID Year Title