Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent (130)

AA Sequence

MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFFLNYLSLSDLC      1 - 70
YTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDRYVAICKPLHYTIIMSRQKCN     71 - 140
TIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVYPLLKLACSNIHMIGLLVIANSGLIALVTFV    141 - 210
VLLLSYVFILYTIRAYSAERRSKALATCSSHVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMF    211 - 280
NPLIYTLRNTEMKNAMRKVWCCQILLKRNQLF                                          281 - 312
//

Text Mined References (1)

PMID Year Title
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.