Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (136)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

AA Sequence

MELLTNNLKFITDPFVCRLRHLSPTPSEEHMKNKNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGN      1 - 70
LLIIVTIMASQSLGSPMYFFLASLSFIDTVYSTAFAPKMIVDLLSEKKTISFQGCMAQLFMDHLFAGAEV     71 - 140
ILLVVMAYDRYMAICKPLHELITMNRRVCVLMLLAAWIGGFLHSLVQFLFIYQLPFCGPNVIDNFLCDLY    141 - 210
PLLKLACTNTYVTGLSMIANGGAICAVTFFTILLSYGVILHSLKTQSLEGKRKAFYTCASHVTVVILFFV    211 - 280
PCIFLYARPNSTFPIDKSMTVVLTFITPMLNPLIYTLKNAEMKSAMRKLWSKKVSLAGKWLYHS          281 - 344
//

Text Mined References (4)

PMID Year Title
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.