Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (205)


  Disease Relevance (2)

AA Sequence

VIPMLNPLIYSLRNKDVNKALRKVMGSKIHS                                           281 - 311

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.