Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (205)

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 5.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.8

AA Sequence

MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMTALIQVSSRLHTPVYFFLSHLSFVD      1 - 70
FCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCGVTEVFLLAVMAYDRFVAICNPLLYMVTMSQKL     71 - 140
RVELTSCCYFCGTVCSLIHSSLALRILFYRSNVINHFFCDLPPLLSLACSDVTVNETLLFLVATLNESVT    141 - 210
IMIILTSYLLILTTILKIHSAESRHKAFSTCASHLTAITVSHGTILYIYCRPSSGNSGDVDKVATVFYTV    211 - 280
VIPMLNPLIYSLRNKDVNKALRKVMGSKIHS                                           281 - 311
//

Text Mined References (3)

PMID Year Title