Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (119)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00104821351867176

Synonym

Accession Q8NGK6 Q6IF91
Symbols OR11-13

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG
Cow OMA Inparanoid
Opossum OMA Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG

Gene RIF (2)

PMID Text
19795399 Observational study of gene-disease association. (HuGE Navigator)
12732197 This publication uses 'GPR134' as a name for this gene.

AA Sequence

MLGPAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYITALLGNTLIVTAIWMDSTRHEPMYCFLCVL      1 - 70
AAVDIVMASSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYVAICKPLHYKRIL     71 - 140
TPQVMLGMSMAVTIRAVTFMTPLSWMMNHLPFCGSNVVVHSYCKHIALARLACADPVPSSLYSLIGSSLM    141 - 210
VGSDVAFIAASYILILRAVFDLSSKTAQLKALSTCGSHVGVMALYYLPGMASIYAAWLGQDIVPLHTQVL    211 - 280
LADLYVIIPATLNPIIYGMRTKQLLEGIWSYLMHFLFDHSNLGS                              281 - 324
//

Text Mined References (3)

PMID Year Title
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
14983052 2004 The human olfactory receptor gene family.
12732197 2003 Novel human G-protein-coupled receptors.