Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (119)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (2)

PMID Text
19795399 Observational study of gene-disease association. (HuGE Navigator)
12732197 This publication uses 'GPR134' as a name for this gene.

AA Sequence

MLGPAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYITALLGNTLIVTAIWMDSTRHEPMYCFLCVL      1 - 70
AAVDIVMASSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYVAICKPLHYKRIL     71 - 140
TPQVMLGMSMAVTIRAVTFMTPLSWMMNHLPFCGSNVVVHSYCKHIALARLACADPVPSSLYSLIGSSLM    141 - 210
VGSDVAFIAASYILILRAVFDLSSKTAQLKALSTCGSHVGVMALYYLPGMASIYAAWLGQDIVPLHTQVL    211 - 280
LADLYVIIPATLNPIIYGMRTKQLLEGIWSYLMHFLFDHSNLGS                              281 - 324
//

Text Mined References (3)

PMID Year Title
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
14983052 2004 The human olfactory receptor gene family.
12732197 2003 Novel human G-protein-coupled receptors.