Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (91)

Gene RIF (1)

PMID Text
12732197 This publication uses 'GPR135' as a name for this gene.

AA Sequence

MLTFHNVCSVPSSFWLTGIPGLESLHVWLSIPFGSMYLVAVVGNVTILAVVKIERSLHQPMYFFLCMLAA      1 - 70
IDLVLSTSTIPKLLGIFWFGACDIGLDACLGQMFLIHCFATVESGIFLAMAFDRYVAICNPLRHSMVLTY     71 - 140
TVVGRLGLVSLLRGVLYIGPLPLMIRLRLPLYKTHVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVL    141 - 210
ILDSVAIAASYVMIFRAVMGLATPEARLKTLGTCASHLCAILIFYVPIAVSSLIHRFGQCVPPPVHTLLA    211 - 280
NFYLLIPPILNPIVYAVRTKQIRESLLQIPRIEMKIR                                     281 - 317
//

Text Mined References (4)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
14983052 2004 The human olfactory receptor gene family.
12732197 2003 Novel human G-protein-coupled receptors.
12644552 2003 Population differences in the human functional olfactory repertoire.