Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.20

Knowledge Summary

Patent (147)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEPMYLFLAMLAA      1 - 70
IDLVLSSSALPKMLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAMAFDRYVAICKPLHYTKVLTG     71 - 140
SLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCYCEHMAVVRLACGDTSFNNIYGIAVAMFIVV    141 - 210
LDLLLVILSYIFILQAVLLLASQEARYKAFGTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLAN    211 - 280
FYLLFPPMVNPIIYGVKTKQIRESILGVFPRKDM                                        281 - 314
//

Text Mined References (4)

PMID Year Title