Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent (186)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Anorexia nervosa 80 3.629 1.8

AA Sequence

MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHGPMYYFLSMLAM      1 - 70
SDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLRYTSILTT     71 - 140
VRVAQIGIVFSFKSMLLVLPFPFTLRSLRYCKKNQLSHSYCLHQDVMKLACSDNRIDVIYGFFGALCLMV    141 - 210
DFILIAVSYTLILKTVPGIASKKEELKALNTCVSHICAVIIFYLPIINLAVVHRFAGHVSPLINVLMANV    211 - 280
LLLVPPLMKPIVYCVKTKQIRVRVVAKLCQWKI                                         281 - 313
//