Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent (186)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Anorexia nervosa 59 3.607 1.8

AA Sequence

MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHGPMYYFLSMLAM      1 - 70
SDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLRYTSILTT     71 - 140
VRVAQIGIVFSFKSMLLVLPFPFTLRSLRYCKKNQLSHSYCLHQDVMKLACSDNRIDVIYGFFGALCLMV    141 - 210
DFILIAVSYTLILKTVPGIASKKEELKALNTCVSHICAVIIFYLPIINLAVVHRFAGHVSPLINVLMANV    211 - 280
LLLVPPLMKPIVYCVKTKQIRVRVVAKLCQWKI                                         281 - 313
//