Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20
PubTator Score 0.25

Knowledge Summary

Patent (124)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

AA Sequence

MPSASAMIIFNLSSYNPGPFILVGIPGLEQFHVWIGIPFCIIYIVAVVGNCILLYLIVVEHSLHEPMFFF      1 - 70
LSMLAMTDLILSTAGVPKALSIFWLGAREITFPGCLTQMFFLHYNFVLDSAILMAMAFDHYVAICSPLRY     71 - 140
TTILTPKTIIKSAMGISFRSFCIILPDVFLLTCLPFCRTRIIPHTYCEHIGVAQLACADISINFWYGFCV    141 - 210
PIMTVISDVILIAVSYAHILCAVFGLPSQDACQKALGTCGSHVCVILMFYTPAFFSILAHRFGHNVSRTF    211 - 280
HIMFANLYIVIPPALNPMVYGVKTKQIRDKVILLFSKGTG                                  281 - 320
//

Text Mined References (3)

PMID Year Title