Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (121)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00110107034418028

Synonym

Accession Q8NGJ1 B2RNP7 Q6IFF5 Q96R74
Symbols OR11-250

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MDQINHTNVKEFFFLELTRSRELEFFLFVVFFAVYVATVLGNALIVVTITCESRLHTPMYFLLRNKSVLD      1 - 70
IVFSSITVPKFLVDLLSDRKTISYNDCMAQIFFFHFAGGADIFFLSVMAYDRYLAIAKPLHYVTMMRKEV     71 - 140
WVALVVASWVSGGLHSIIQVILMLPFPFCGPNTLDAFYCYVLQVVKLACTDTFALELFMISNNGLVTLLW    141 - 210
FLLLLGSYTVILVMLRSHSGEGRNKALSTCTSHMLVVTLHFVPCVYIYCRPFMTLPMDTTISINNTVITP    211 - 280
MLNPIIYSLRNQEMKSAMQRLQRRLGPSESRKWG                                        281 - 314
//

Text Mined References (5)

PMID Year Title
23910658 2013 Identification of regions associated with variation in sensitivity to food-related odors in the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.