Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (121)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MDQINHTNVKEFFFLELTRSRELEFFLFVVFFAVYVATVLGNALIVVTITCESRLHTPMYFLLRNKSVLD      1 - 70
IVFSSITVPKFLVDLLSDRKTISYNDCMAQIFFFHFAGGADIFFLSVMAYDRYLAIAKPLHYVTMMRKEV     71 - 140
WVALVVASWVSGGLHSIIQVILMLPFPFCGPNTLDAFYCYVLQVVKLACTDTFALELFMISNNGLVTLLW    141 - 210
FLLLLGSYTVILVMLRSHSGEGRNKALSTCTSHMLVVTLHFVPCVYIYCRPFMTLPMDTTISINNTVITP    211 - 280
MLNPIIYSLRNQEMKSAMQRLQRRLGPSESRKWG                                        281 - 314
//

Text Mined References (5)

PMID Year Title