Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.00
PubTator Score 1.50

Knowledge Summary

Patent (94)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (2)

AA Sequence

MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPMYFFLSNLSFI      1 - 70
DVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMAYDRYAAICNPLLYSSIMSPT     71 - 140
LCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFCDMPQLLILSCTDTFFVQVMTAILTMFFGIA    141 - 210
SALVIMISYGYIGISIMKITSAKGRSKAFNTCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYT    211 - 280
VVIPMLNPLIYSLRNKEIKDALKRLQKRKCC                                           281 - 311
//

Text Mined References (5)

PMID Year Title