Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.00
PubTator Score 1.50

Knowledge Summary

Patent (94)

Synonym

Accession Q8NGI8 B9EIS2 Q6IEV4
Symbols OR11-244

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Dog OMA EggNOG
Dog OMA Inparanoid
Horse OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG

Gene RIF (1)

PMID Text
24361078 This study identifed that OR5AN1 was a specific muscone receptor expressed by neurons innervating the muscone-responsive anteromedial glomeruli.

AA Sequence

MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPMYFFLSNLSFI      1 - 70
DVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMAYDRYAAICNPLLYSSIMSPT     71 - 140
LCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFCDMPQLLILSCTDTFFVQVMTAILTMFFGIA    141 - 210
SALVIMISYGYIGISIMKITSAKGRSKAFNTCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYT    211 - 280
VVIPMLNPLIYSLRNKEIKDALKRLQKRKCC                                           281 - 311
//

Text Mined References (4)

PMID Year Title
24361078 2014 Olfactory receptor and neural pathway responsible for highly selective sensing of musk odors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.