Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent (92)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00221533854077547

Synonym

Accession Q8NGI6 B2RNH6
Symbols OST711
OR4D10P
OR11-251

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG
Rat OMA Inparanoid
Platypus OMA EggNOG

AA Sequence

MEMENCTRVKEFIFLGLTQNREVSLVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLHNLSIAD      1 - 70
ICFSSITVPKVLVDLLSERKTISFNHCFTQMFLFHLIGGVDVFSLSVMALDRYVAISKPLHYATIMSRDH     71 - 140
CIGLTVAAWLGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVHRVLKLAHTDIFILELLMISNNGLLTTLW    141 - 210
FFLLLVSYIVILSLPKSQAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPMDKAISVTFTVISP    211 - 280
LLNPLIYTLRNHEMKSAMRRLKRRLVPSDRK                                           281 - 311
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12644552 2003 Population differences in the human functional olfactory repertoire.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.