Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent (92)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MEMENCTRVKEFIFLGLTQNREVSLVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLHNLSIAD      1 - 70
ICFSSITVPKVLVDLLSERKTISFNHCFTQMFLFHLIGGVDVFSLSVMALDRYVAISKPLHYATIMSRDH     71 - 140
CIGLTVAAWLGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVHRVLKLAHTDIFILELLMISNNGLLTTLW    141 - 210
FFLLLVSYIVILSLPKSQAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPMDKAISVTFTVISP    211 - 280
LLNPLIYTLRNHEMKSAMRRLKRRLVPSDRK                                           281 - 311
//

Text Mined References (5)

PMID Year Title