Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (64)


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00122270550797572

AA Sequence

LLNPLIYTLRNQEMKSAMRRLKRRLVPSERE                                           281 - 311

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.