Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (156)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 5.3e-17
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.400 5.3e-17

AA Sequence

MLTLNKTDLIPASFILNGVPGLEDTQLWISFPFCSMYVVAMVGNCGLLYLIHYEDALHKPMYYFLAMLSF      1 - 70
TDLVMCSSTIPKALCIFWFHLKDIGFDECLVQMFFTHTFTGMESGVLMLMALDRYVAICYPLRYSTILTN     71 - 140
PVIAKVGTATFLRGVLLIIPFTFLTKLLPYCRGNILPHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIWG    141 - 210
FDILCITNSYTMILRAVVSLSSADARQKAFNTCTAHICAIVFSYTPAFFSFFSHRFGEHIIPPSCHIIVA    211 - 280
NIYLLLPPTMNPIVYGVKTKQIRDCVIRILSGSKDTKSYSM                                 281 - 321
//

Text Mined References (5)

PMID Year Title