Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 0.01415464582607

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.014

AA Sequence

MLVVLQELRDSNSSKFQVSEFILMGFPGIHSWQHWLSLPLALLYLLALSANILILIIINKEAALHQPMYY      1 - 70
FLGILAMADIGLATTIMPKILAILWFNAKTISLLECFAQMYAIHCFVAMESSTFVCMAIDRYVAICRPLR     71 - 140
YPSIITESFVFKANGFMALRNSLCLISVPLLAAQRHYCSQNQIEHCLCSNLGVTSLSCDDRRINSINQVL    141 - 210
LAWTLMGSDLGLIILSYALILYSVLKLNSPEAASKALSTCTSHLILILFFYTVIIVISITRSTGMRVPLI    211 - 280
PVLLNVLHNVIPPALNPMVYALKNKELRQGLYKVLRLGVKGT                                281 - 322
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.