Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGNVTILFIIWMD      1 - 70
PSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMFFTHAFSSMESGVLVAMALDR     71 - 140
YVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLILLRKLIFCQATIIGHAYCEHMAVVKLACSET    141 - 210
TVNRAYGLTVALLVVGLDVLAIGVSYAHILQAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTH    211 - 280
RFGHHVPHHVHVLLAILYRLVPPALNPLVYRVKTQKIHQ                                   281 - 319
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.