Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (154)

Synonym

Accession Q8NGH5 B2RNI2 Q6IFL0
Symbols OR11-75

Gene

PANTHER Protein Class (2)

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Cow OMA Inparanoid

AA Sequence

MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQPLYYLL      1 - 70
SLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESCTFMVMAYDRYVAICHPLRYP     71 - 140
SIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENVIENCICANLSVSRLSCDNFTLNRIYQFVAG    141 - 210
WTLLGSDLFLIFLSYTFILRAVLRFKAEGAAVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDIL    211 - 280
ILLNVLHHLIPPALNPIVYGVRTKEIKQGIQKLLQRGR                                    281 - 318
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.