Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (183)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Anxiety Disorders 37

Synonym

Accession Q8NGG7 Q6IEW7 Q96RC6
Symbols OST025
OR11-318

Gene

AA Sequence

MGFLSPMHPCRPPTQRRMAAGNHSTVTEFILKGLTKRADLQLPLFLLFLGIYLVTIVGNLGMITLICLNS      1 - 70
QLHTPMYYFLSNLSLMDLCYSSVITPKMLVNFVSEKNIISYAGCMSQLYFFLVFVIAECYMLTVMAYDRY     71 - 140
VAICHPLLYNIIMSHHTCLLLVAVVYAIGLIGSTIETGLMLKLPYCEHLISHYFCDILPLMKLSCSSTYD    141 - 210
VEMTVFFSAGFNIIVTSLTVLVSYTFILSSILGISTTEGRSKAFSTCSSHLAAVGMFYGSTAFMYLKPST    211 - 280
ISSLTQENVASVFYTTVIPMLNPLIYSLRNKEVKAAVQKTLRGKLF                            281 - 326
//

Text Mined References (6)

PMID Year Title
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.