Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14
PubTator Score 0.33

Knowledge Summary

Patent (191)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cervical Dystonia 26 4.287 2.1

AA Sequence

MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSFMEICYSSATA      1 - 70
PKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICKPLSYTTIMNWQVCTVLVGIA     71 - 140
WVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLACSDTFLIGLLIVANGGTLSVISFGVLLASY    141 - 210
MVILLHLRTWSSEGWCKALSTCGSHFAVVILFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYS    211 - 280
LRNAEMRKAMKRLWIRTLRLNEK                                                   281 - 303
//

Text Mined References (7)

PMID Year Title